# Developing College-Level ID/Creation Courses

**URL:** <https://discourse.peacefulscience.org/t/developing-college-level-id-creation-courses/7408>\
**Category:** Side Conversation\
**Created:** [August 13, 2019, 3:57am UTC](https://discourse.peacefulscience.org/t/developing-college-level-id-creation-courses/7408 "2019-08-13T03:57:46Z")\
**Posts on this page:** 1\
**Showing post:** 374

<div class="post-metadata">

**Author:** ![stcordova](https://sea2.discourse-cdn.com/flex016/user_avatar/discourse.peacefulscience.org/stcordova/32/2030_2.png) [@stcordova](https://discourse.peacefulscience.org/u/stcordova)\
**Post date:** [August 21, 2019, 5:59pm UTC](https://discourse.peacefulscience.org/t/developing-college-level-id-creation-courses/7408/374 "2019-08-21T17:59:11Z")

</div>

> [@Faizal\_Ali](#):
>
> OTOH, if we were only tossing two coins, the odds are 1/4. Pretty good chance you would get it on your first try, and a near certainty you’d get it in at most a matter of minutes.

Agreed.

> So if I said the odds of functional protein arising thru evolution it similar to that of two coins coming up heads, would you buy that argument? If not, why should we buy the argument you similarly just pulled out of thin air?

Some proteins,such as TopoIsomerase and Helicase I consider highly improbable as a matter of principle. There is a thread that is discussion those issue now.

> [@Is Helicase a House of Cards?](https://discourse.peacefulscience.org/t/is-helicase-a-house-of-cards/7509):
>
> I don’t see how that applies to evolution. A bit of added explanation . . . I went to a webtool that produces random protein sequences and got this result for a 100 residue protein: QAVTYAGGGMMKATETFEELDASVTLPLCIKLGPHGTVNAHSEMGRWVVFEWQHNIISQPRTDIEAKWSGCPIWPQMFFHEMIYEPALTVDLNIEWWHPG The chances of any specific 100 aa protein is 1x20^100. Therefore, the chances of getting that protein was 1 in 1.6x10^260. According to ID arguments, there is no way that a random sequence generator could have produced that rare of a sequence, yet it did. In fact, I can keep doing this with ease.

---

_[View the full topic](https://discourse.peacefulscience.org/t/developing-college-level-id-creation-courses/7408)._