How much is enough? This seems to be an entirely arbitrary criteria.
It is strange that someone thinks descent with modification is a problem for a theory that is based on descent with modification. What next? The observation of length and time contraction are problems for relativity?
Fair point. How about what we can show by experiment what reproduction can produce?
How would this produce evidence for separate origins of two species groups billions of years ago? You need to supply positive evidence for your claims of design, not simply pick at someone elseâs theories. Focus on your positive claims and provide evidence for them.
Yes.
Can you please provide the evidence that they were produced by a mind, along with the detailed step-by-step process by which this happened? Thanks.
The functional information inside DNA to start. Your next move is to say that is not evidence and so we stalemate. Just avoiding an endless loop of exchanges.
Where was the detailed step-by-step process I asked for?
Why are you asking questions you already know the answer to? Where is the detailed step by step process how the atomic components of gravity curves space time? Letâs just agree to disagree and not go 20 rounds of nonsense exchange.
Irony meter stocks just keeps going up. Everyone keeps having to buy new ones!
Then stop asking for nonsense like a movie of the process of the first eukaryotic cell evolving.
If you canât take it, donât dish it out, Bill.
When I put a 
at the end I am kidding. I was responding to Tâs nonsense requests.
I think youâve been forgetting to put a lot of 
's at the end of your posts, because they all read like bad jokes.
I apologize Faizal.
Also, try not to misspell my name, if itâs not too much trouble.
Faizal sorry. Especially now its your real name
Ok. Does this sequence have FI, and was it made by a mind?
GVGICQSWMFVQKKMDCIGLCIPMIIMMIQGSSAYTKHKMAFTPRNSNLAFMVHHISQWG
SGDARVDAEMQINKPQWLNEKNGNTHFNEYFMGDMYDQIGRKTRNQSGDFSGFALPCFFY
TEYRNCHRLRIGNHRRNYFTHKYCSKEWPVFPCGPYFSKNDFGIMSYHQYSTALSHECLV
TAGEHDHFQSNIKIMMHEYS
How did you calculate FI, and how does the calculation test your hypothesis?
This is an interesting question. Thanks. I will think about it and post it at UD.
ffs ROFL!
Of course. Or, hey, since youâre only going to reveal it to the best and brightest, why not just submit it to Nature?
On another forum there was a poster, AFDave Hawkins, who was such a caricature of a Creationist he has a series of Internet âLawsâ named after him. One standard was
Second Law: One may escape intellectual responsibility on any issue merely by stating an intent to pursue it.
How would you explain conservation through deep time if not by assuming that any change that would have occurred within the conserved part of a protein would have been eliminated by negative selection ? Just curious.