Is Helicase a House of Cards?

[Roy (34-year veteran)]

@Roy

@Giltil

@T_aquaticus

According to ID arguments, there is no way that a random sequence generator could have produced that rare of a sequence

This is utterly false. Clearly, you don’t understand ID theory.

he clearly does understand ID theory, and you’ve just as clearly been suckered by it.

Ok, Using a random sequence generator, you came across the following sequence:
QAVTYAGGGMMKATETFEELDASVTLPLCIKLGPHGTVNAHSEMGRWVVFEWQHNIISQPRTDIEAKWSGCPIWPQMFFHEMIYEPALTVDLNIEWWHPG
According to ID theory, because this sequence doesn’t match any SPECIFICATION, no design inference is warranted.

Where is the SPECIFICATION for the helicase protein?
By your own argument, if you can’t produce one, no design inference is warranted.

Cue back-pedalling and special pleading…

More than a week later, and no specification for the helicase protein has been produced.
There wasn’t even any back-pedalling or special pleading, just the tranquil silence of a field that’s been fled.